Print…

You Searched For: COVID+sign


1,597  results were found

Refine Results Sort by
SearchResultCount:"1597"

Sort Results

List View Easy View (new)

Rate These Search Results

Vendor Image-76630-330

Anti-S Recombinant Antibody [Clone: CR3022]

Catalog Number: (76630-330)
Supplier: Prosci
Description: ANTIBODY COVID-19 SARS-COV S GP CR3022
Vendor Image-77132-668

SARS-CoV-2 (COVID-19) Spike Recombinant S1+S2 ECD (S-ECD) Protein (from HEK293 cells)

Catalog Number: (77132-668)
Supplier: Prosci
Description: RECOMBINANT PROTEIN 10 121
Vendor Image-77132-114

SARS-CoV-2 (COVID-19) Recombinant S Protein RBD (from HEK293 cells)

Catalog Number: (77132-114)
Supplier: Prosci
Description: RECOMBINANT PROTEIN 11 215
Product Image-470330-932

COVID-19 - Keeping Students and Teachers Safe At School Video Series

Supplier: TMW Media Group
Description: Video support for return to classroom training.

Vendor Image-77133-092

SARS-CoV-2 (COVID-19) Recombinant Nucleocapsid Protein (from E. coli)

Catalog Number: (77133-092)
Supplier: Prosci
Description: RECOMBINANT PROTEIN 10 410
Vendor Image-77124-038

SARS-CoV-2 (COVID-19) Recombinant RBD Protein (from HEK293 cells)

Catalog Number: (77124-038)
Supplier: Prosci
Description: RECOMBINANT PROTEIN 10 078
Vendor Image-76629-760

Anti-S Recombinant Antibody [Clone: CR3022]

Catalog Number: (76629-760)
Supplier: Prosci
Description: ANTIBODY COVID-19 SARS-COV CR3022 IGG
Vendor Image-76629-982

Anti-S Recombinant Antibody [Clone: CR3022]

Catalog Number: (76629-982)
Supplier: Prosci
Description: ANTIBODY COVID-19 SARS-COV S GP CR3022
Vendor Image-77134-130

SARS-CoV-2 (COVID-19) Recombinant NSP8 Protein (from E. coli)

Catalog Number: (77134-130)
Supplier: Prosci
Description: RECOMBINANT PROTEIN 10 415
Vendor Image-77133-330

SARS-CoV-2 (COVID-19) Recombinant Spike Protein (from E. coli)

Catalog Number: (77133-330)
Supplier: Prosci
Description: RECOMBINANT PROTEIN 92 761
Vendor Image-77127-772

SARS-CoV-2 (COVID-19) Recombinant Spike Protein (from E. coli)

Catalog Number: (77127-772)
Supplier: Prosci
Description: RECOMBINANT PROTEIN 92 760
Vendor Image-77132-590

SARS-CoV-2 (COVID-19) Recombinant Nucleocapsid (N) Protein (from HEK293 cells)

Catalog Number: (77132-590)
Supplier: Prosci
Description: RECOMBINANT PROTEIN 10 080
Vendor Image-77120-146

SARS-CoV-2 (COVID-19) Recombinant Trimeric Spike (S) Protein (from HEK293 cells)

Catalog Number: (77120-146)
Supplier: Prosci
Description: QCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTN
GTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFC
NDPFLGVYYHKNNKS...
Vendor Image-77131-548

SARS-CoV-2 (COVID-19) ORF3b Peptide

Catalog Number: (77131-548)
Supplier: Prosci
Description: PEPTIDE 9281P
Vendor Image-77133-936

SARS-CoV-2 (COVID-19) ORF7a Peptide

Catalog Number: (77133-936)
Supplier: Prosci
Description: PEPTIDE 9283P
Product Image-470233-080

Wallcur® Instructor Locator Sign

Catalog Number: (470233-080)
Supplier: WALLCUR, LLC.
Description: Easily Identify Where You Are For Students
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,281 - 1,296 of 1,597
no targeter for Bottom