Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Due to scheduled system maintenance, vwr.com will be temporarily unavailable from 6:00 am EST to 2:00 PM EST on Sunday, October 23. 

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

COVID+sign


1,597  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
SearchResultCount:"1597"
  List View Searching Easy View Easy View (new)
Sort by:
 
 
 
 

Supplier:  Prosci
Description:   PEPTIDE 9463P
Supplier:  Prosci
Description:   RECOMBINANT PROTEIN 20 203
Supplier:  Prosci
Description:   RECOMBINANT PROTEIN 20 229
Supplier:  Prosci
Description:   RECOMBINANT PROTEIN 20 230
Supplier:  Prosci
Description:   RECOMBINANT PROTEIN 20 205
Supplier:  Prosci
Description:   Native Sequence: MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEI...
Supplier:  ACCUFORM MANUFACTURING, INC
Description:   Premium Vinyl
Supplier:  Prosci
Description:   PEPTIDE 9689P
Supplier:  Prosci
Description:   RECOMBINANT PROTEIN 92 748
Supplier:  Prosci
Description:   RECOMBINANT PROTEIN 11 064
Supplier:  Prosci
Description:   RECOMBINANT PROTEIN 21 806
Supplier:  Prosci
Description:   Native Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMF...
Supplier:  Prosci
Description:   RECOMBINANT PROTEIN 10 426
Supplier:  Prosci
Description:   Native Sequence: MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEI...
Supplier:  Prosci
Description:   RECOMBINANT PROTEIN 11 067
Supplier:  Prosci
Description:   RECOMBINANT PROTEIN 21 831
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,393 - 1,408  of 1,597
Prev   88  89  90  91  92  93  94  95  96  97  98  99  100  Next