Print…

You Searched For: COVID+sign


1,597  results were found

Refine Results Sort by
SearchResultCount:"1597"

Sort Results

List View Easy View (new)

Rate These Search Results

Vendor Image-77133-712

Human Recombinant SARS-CoV-2 (COVID-19) Alpha Variant (B.1.1.7, UK) Spike S1 (RBD) Protein (from HEK293 cells)

Catalog Number: (77133-712)
Supplier: Prosci
Description: RECOMBINANT PROTEIN 21 811
Vendor Image-77127-184

Anti-Envelope Protein Rabbit Polyclonal Antibody (HRP (Horseradish Peroxidase))

Catalog Number: (77127-184)
Supplier: Prosci
Description: SARS-CoV-2 (COVID-19) Envelope antibody can be stored at 4 °C for three months and −20 °C, stable for up to one year. As with all antibodies care shou...
Vendor Image-77123-214

Anti-Spike Protein Rabbit Polyclonal Antibody

Catalog Number: (77123-214)
Supplier: Prosci
Description: SARS-CoV-2 (COVID-19) Spike antibody (cleavage site) can be stored at 4 to 730 °C for three months and –20 to +730 °C, stable for up to one year. As w...
Vendor Image-77126-888

Human Recombinant SARS-CoV-2 (COVID-19) Beta Variant (B.1.351, SA) Spike S1 (RBD) Protein (from HEK293 cells)

Catalog Number: (77126-888)
Supplier: Prosci
Description: RECOMBINANT PROTEIN 21 812
Vendor Image-77131-532

SARS-CoV-2 (COVID-19, 2019-nCoV) Recombinant Omicron Variant (B.1.1.529) Nucleocapsid Protein (from E. coli)

Catalog Number: (77131-532)
Supplier: Prosci
Description: RECOMBINANT PROTEIN 21 850
Vendor Image-77133-492

Anti-Nucleoprotein Rabbit Polyclonal Antibody

Catalog Number: (77133-492)
Supplier: Prosci
Description: SARS-CoV-2 (COVID-19) Nucleocapsid antibody can be stored at 4 to 730 °C for three months and –20 to +730 °C, stable for up to one year. As with all a...
Vendor Image-77126-722

Anti-Surface Glycoprotein Rabbit Polyclonal Antibody (HRP (Horseradish Peroxidase))

Catalog Number: (77126-722)
Supplier: Prosci
Description: SARS-CoV-2 (COVID-19) Spike antibody can be stored at 4 °C for three months and −20 °C, stable for up to one year. As with all antibodies care should ...
Vendor Image-77121-858

Anti-Spike Protein Rabbit Polyclonal Antibody

Catalog Number: (77121-858)
Supplier: Prosci
Description: SARS-CoV-2 (COVID-19) Spike antibody can be stored at 4 to 730 °C for three months and –20 to +730 °C, stable for up to one year. As with all antibodi...
Vendor Image-77132-824

SARS-CoV-2 (COVID-19) Recombinant Spike S1 (K417N, E484K, N501Y) Protein (from HEK293 Cells)

Catalog Number: (77132-824)
Supplier: Prosci
Description: RECOMBINANT PROTEIN 20 183
Vendor Image-77129-984

SARS-CoV-2 (COVID-19) Recombinant NSP11 NSP12 Protein (from bacteria)

Catalog Number: (77129-984)
Supplier: Prosci
Description: Native Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMF...
Vendor Image-77120-540

Anti-Surface Glycoprotein Rabbit Polyclonal Antibody (Biotinylated)

Catalog Number: (77120-540)
Supplier: Prosci
Description: SARS-CoV-2 (COVID-19) Spike RBD antibody (biotin) can be stored at 4 °C for three months and −20 °C, stable for up to one year. As with all antibodies...
Vendor Image-77124-452

Anti-Spike Protein Rabbit Polyclonal Antibody

Catalog Number: (77124-452)
Supplier: Prosci
Description: SARS-CoV-2 (COVID-19) Spike antibody (cleavage site) can be stored at 4 to 730 °C for three months and –20 to +730 °C, stable for up to one year. As w...
Vendor Image-77122-170

Anti-Surface Glycoprotein Rabbit Polyclonal Antibody (Biotinylated)

Catalog Number: (77122-170)
Supplier: Prosci
Description: SARS-CoV-2 (COVID-19) Spike antibody (biotin) can be stored at 4 °C for three months and −20 °C, stable for up to one year. As with all antibodies car...
Vendor Image-77124-984

SARS-CoV-2 (COVID-19) Recombinant South African variant (B.1.351) S RBD (K417N, E484K, N501Y) Protein (from Mammalian Cells)

Catalog Number: (77124-984)
Supplier: Prosci
Description: RECOMBINANT PROTEIN 11 065
Vendor Image-77121-482

SARS-CoV-2 (COVID-19) Recombinant NSP11 NSP12 Protein (from bacteria)

Catalog Number: (77121-482)
Supplier: Prosci
Description: Native Sequence: MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEI...
Vendor Image-77127-836

Anti-Spike Protein Rabbit Polyclonal Antibody

Catalog Number: (77127-836)
Supplier: Prosci
Description: SARS-CoV-2 (COVID-19) P681H Mutant Specific Spike antibody can be stored at 4 to 730 °C for three months and –20 to +730 °C, stable for up to one year...
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,425 - 1,440 of 1,597
no targeter for Bottom