Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Isolation+and+Cleanup+HyClone+products+(Cytiva)


47,870  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"47870"
  List View Searching Easy View Easy View (new)
Sort by:
 
 
 
 

Supplier:  Biotium
Description:   CD45 / LCA Monoclonal antibody, Clone: 2B11 + PD7/26, Host: Mouse, Species reactivity: Human, Dog, Isotype: IgG's, Conjugate: purified, Immunogen: Isolated neoplastic cells from T cell lymphoma, Synonyms: B220, CD45R, Application: IF, Size: 100uL
Supplier:  HiMedia
Description:   For the selective isolation and cultivation of <i>Candida</i> species.
MSDS SDS

Supplier:  Genetex
Description:   This is a receptor for nicotinic acid. Its expression has been reported in adipose and spleen, as well as lymphocytes and monocytes. ESTs have been isolated from adipose, blood, liver, liver/spleen, placenta, prostate, and testis libraries.
Supplier:  HARDY DIAGNOSTICS CA
Description:   CRITERION™ Columbia CNA Agar Base is intended to be used as a selective basal media to which blood is added for the selective isolation and differentiation of gram-positive cocci.
Dehydratedculture media with engineered container.

Supplier:  Genetex
Description:   G protein-coupled receptors (GPCRs, or GPRs) contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins. GPCR GPR115 is a member of this family (subfamily Orphan-B). ESTs have been isolated from breast, heart, and placenta libraries.

Supplier:  Stemcell Technologies
Description:   Immunomagnetic positive selection of any cells with your own mouse IgG1 antibody.
Supplier:  Bachem Americas
Description:   See also CKS-17 (H-7600) and (Dap²²)-ShK (H-4218).

Supplier:  Bioss
Description:   Three different forms of human pancreatic procarboxypeptidase A have been isolated. This gene encodes a monomeric pancreatic exopeptidase involved in zymogen inhibition. [provided by RefSeq, Jan 2009].
Catalog Number: (77439-310)

Supplier:  Bioss
Description:   High affinity receptor for the C-C type chemokines CCL17/TARC and CCL22/MDC. The activity of this receptor is mediated by G(i) proteins which activate a phosphatidylinositol-calcium second messenger system. Can function as a chemoattractant homing receptor on circulating memory lymphocytes and as a coreceptor for some primary HIV-2 isolates. In the CNS, could mediate hippocampal-neuron survival.
Supplier:  Labconco
Description:   Accessories for Protector® Controlled Atmosphere Glove Box, Labconco
Product available on GSA Advantage®
Supplier:  Anaspec Inc
Description:   This hypophysiotropic peptide was isolated from human hypothalamic-hypophysial tissues. Within this 1 to 29 amino acid GRF fragment, amino acids 13 to 21 are more important than 24 to 29 for high affinity receptor binding. Structure–activity studies show that hpGRF(1–29)-NH2 has full intrinsic activity and potency in vitro as the full length GRF in stimulating growth hormone release. Human GRF (1-29) has a high degree (>93%) homology with procine, bovine and ovine GRF (1-29)-NH2.
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
MW: 3357.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Supplier:  HARDY DIAGNOSTICS CA
Description:   For the selective isolation of Legionella spp.
MSDS SDS
Catalog Number: (10072-128)

Supplier:  Prosci
Description:   I-TAC is a "non-ELR" CXC chemokine that is regulated by interferon and signals through the CXCR3 receptor. I-TAC is chemoattractant for IL-2 activated T cells, but does not affect freshly isolated un-stimulated T cells, neutrophils, or monocytes. Recombinant murine I-TAC is a 9.0 kDa protein containing 79 amino acid residues including the four highly conserved cysteine residues present in CXC chemokines.
Supplier:  Enzo Life Sciences
Description:   Hsp65 is a member of the Hsp60 family of heat shock proteins isolated from Mycobacterium bovis BCG. Hsp65 from M. bovis is identical to that of M. tuberculosis, and similar to that of M. leprae, two highly pathogenic strains of mycobacterium. Hsp65 is the immunodominant antigen during mycobacterial infection and vaccination, and has been linked to the development of autoimmune adjuvant arthritis in rats.
Supplier:  HiMedia
Description:   For the isolation and identification of <i>Brucella</i> species.
MSDS SDS

Supplier:  Bioss
Description:   Three different forms of human pancreatic procarboxypeptidase A have been isolated. This gene encodes a monomeric pancreatic exopeptidase involved in zymogen inhibition. [provided by RefSeq, Jan 2009].
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
2,017 - 2,032  of 47,870