Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Isolation+and+Cleanup+HyClone+products+(Cytiva)


47,867  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"47867"
  List View Searching Easy View Easy View (new)
Sort by:
 
 
 
 

Supplier:  Bachem Americas
Description:   Substrates often used for characterizing newly isolated PPIases, subtilisins or other enzymes. Bachem offers Suc-Ala-Ala-Pro-Xaa (Suc-AAPX) substrates containing Ala, Leu, Met, Nle, and Nva (the pancreatic elastase substrates L-1775, L-1390, L-1395, and L-1780), Arg, Asp, Glu, Ile, Lys, Orn, Phe (the PPIase substrates I-1465, L-1400, and M-2305), and Val (the neutrophil elastase substrates I-1490 and L-1770) as Xaa.
Supplier:  New England Biolabs (NEB)
Description:   Duplex DNA is isolated from bacteriophage lambda (cI857ind 1 Sam 7)
Supplier:  GE Healthcare - Whatman
Description:   Constructed of chemically resistant, biologically inert polypropylene, plates are optimized for a variety of applications requiring larger per well volume processing.
Catalog Number: (102999-386)

Supplier:  Anaspec Inc
Description:   The peptide, corticotropin releasing factor (CRF) was first isolated in the mammalian brain that regulates the hypothalamic-pituitary-adrenocortical axis. It also plays a key role in modulating the endocrine, autonomic, and behavioral responses to stress and cardiovascular, gastrointestinal, and immune activities.
Sequence: SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
MW: 4670.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier:  Discovery Labware
Description:   BD Isolator Cleanroom eXtended Temperature (IC-XT) plated media offer flexibility and sample security to meet today's environmental monitoring needs.
New Product
Supplier:  HiMedia
Description:   Dehydrated culture media for enrichment, isolation, cultivation, and maintenance of microorganisms.
MSDS SDS
Supplier:  HiMedia
Description:   An antibiotic supplement recommended for the selective isolation of <i>Burkholderia cepacia</i>.
Supplier:  BD
Description:   Prepared plated media are designed for the isolation of microorganisms from samples or specimens.
MSDS SDS
Supplier:  HiMedia
Description:   Dehydrated culture media for enrichment, isolation, cultivation, and maintenance of microorganisms.
MSDS SDS

Supplier:  Bioss
Description:   Receptor for a number of inflammatory CC-chemokines including MIP-1-alpha, MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation. Acts as a coreceptor (CD4 being the primary receptor) for HIV-1 R5 isolates.
Supplier:  Bachem Americas
Description:   Substrates often used for characterizing newly isolated PPIases, subtilisins or other enzymes. Bachem offers Suc-Ala-Ala-Pro-Xaa (Suc-AAPX) substrates containing Ala, Leu, Met, Nle, and Nva (the pancreatic elastase substrates L-1775, L-1390, L-1395, and L-1780), Arg, Asp, Glu, Ile, Lys, Orn, Phe (the PPIase substrates I-1465, L-1400, and M-2305), and Val (the neutrophil elastase substrates I-1490 and L-1770) as Xaa.
Supplier:  GE Healthcare - Life Sciences

Supplier:  Genetex
Description:   The G protein-coupled receptor GPCR GPR81 has been reported primarily in adipose and pituitary. ESTs have been isolated from human bladder cancer and colon cancer libraries. It has not been detected in frontal, temporal and occipital lobes of the cortex, basal forebrain, caudate nucleus, nucleus accumbens, and hippocampus.
Supplier:  GE Healthcare - Life Sciences
Description:   Protein G Mag Sepharose simplifies enrichment of target proteins by immunoprecipitation techniques, protein antigen precipitation from solutions using antibodies, or pull-down applications as an in vitro technique to detect physical interactions.
MSDS SDS
Supplier:  HiMedia
Description:   Dehydrated culture media for enrichment, isolation, cultivation, and maintenance of microorganisms.
MSDS SDS
Catalog Number: (CA10500-512)

Supplier:  GE Healthcare - Life Sciences
Description:   Designed to provide connection of syringe to top of column.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
2,193 - 2,208  of 47,867