Isolation+and+Cleanup+HyClone+products+(Cytiva)
Supplier:
Honeywell Safety Products
Description:
Comfortable half-mask or full facepiece respirators for use with North Safety Products cartridges and filters.
Supplier:
Bel-Art Products
Description:
This small plastic vacuum desiccator is ideal for degasing liquids quickly and easily in the laboratory or classroom.
Supplier:
Bel-Art Products
Description:
Turning the rack to one side will slant tubes 5° to produce a large surface area useful for aerobic cultures.
Catalog Number:
(10391-134)
Supplier:
Bioss
Description:
Galactokinase is a major enzyme for the metabolism of galactose and its deficiency causes congenital cataracts in the adult population. GALK1 sequence shares the greatest level of conservation, 44.5% identity with that from E. coli and 34.6% amino acid identity with the product of the human GALK2 gene.
Supplier:
Colder Products
Description:
3/8" flow quick disconnect couplings offer high flow capacity in a compact size
Catalog Number:
(10407-370)
Supplier:
Bioss
Description:
Beta-oxidation of fatty acids. The highest activity concerns the C6 to C10 chain length substrate. Converts the end product of pristanic acid beta oxidation, 4,8-dimethylnonanoyl-CoA, to its corresponding carnitine ester.
Catalog Number:
(10407-366)
Supplier:
Bioss
Description:
Beta-oxidation of fatty acids. The highest activity concerns the C6 to C10 chain length substrate. Converts the end product of pristanic acid beta oxidation, 4,8-dimethylnonanoyl-CoA, to its corresponding carnitine ester.
Catalog Number:
(10406-260)
Supplier:
Bioss
Description:
Mediates interactions of advanced glycosylation end products (AGE). These are nonenzymatically glycosylated proteins which accumulate in vascular tissue in aging and at an accelerated rate in diabetes. Acts as a mediator of both acute and chronic vascular inflammation in conditions such as atherosclerosis and in particular as a complication of diabetes. AGE/RAGE signaling plays an important role in regulating the production/expression of TNF-alpha, oxidative stress, and endothelial dysfunction in type 2 diabetes. Interaction with S100A12 on endothelium, mononuclear phagocytes, and lymphocytes triggers cellular activation, with generation of key proinflammatory mediators. Interaction with S100B after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling (By similarity). Receptor for amyloid beta peptide. Contributes to the translocation of amyloid-beta peptide (ABPP) across the cell membrane from the extracellular to the intracellular space in cortical neurons. ABPP-initiated RAGE signaling, especially stimulation of p38 mitogen-activated protein kinase (MAPK), has the capacity to drive a transport system delivering ABPP as a complex with RAGE to the intraneuronal space. Can also bind oligonucleotides.
Catalog Number:
(10086-476)
Supplier:
Proteintech
Description:
ELL is an elongation factor that inrecase the catalytic rate of RNA polymerase II transcription via suppressing transient pausing by the polymerase at multiple sites along the DNA. Also it's the second elongation factor to be involved in oncogenesis which is a transcription factor regulated by the product of the von Hippel-Lindau tumor suppressor. There are two transcirpts variants in mRNA level, one is 4.4kb transcript and the other is 2.8kb transcript.
Catalog Number:
(10111-124)
Supplier:
Prosci
Description:
PDCD4 is a protein localized to the nucleus in proliferating cells. Expression of this gene is modulated by cytokines in natural killer and T cells. The gene product is thought to play a role in apoptosis but the specific role has not yet been determined. Two transcripts encoding different isoforms have been identified.
Supplier:
Spectrum Chemicals
Description:
Acetic Acid, Glacial, FCC is used in the pickling of vegetables and other foods. Spectrum Chemical offers over 300 Food Grade (FCC) chemical ingredients packaged in laboratory size bottles to production drum quantities and are manufactured, packaged and stored under current Good Manufacturing Practices (cGMP) per 21CFR part 211 in FDA registered and inspected facilities.
Catalog Number:
(76338-214)
Supplier:
Marlin Steel Wire Products
Description:
A versatile material handling conveyor basket that can be used to save space and improve efficiency in a variety of manufacturing and distribution operations.
Catalog Number:
(RK30004)
Supplier:
Restek
Description:
Mix contains: 1-Bromo-4-fluorobenzene (BFB) (460-00-4), 1,2-Dichloroethane-d4 (17060-07-0) and Toluene-d8 (2037-26-5).
Catalog Number:
(102996-228)
Supplier:
Anaspec Inc
Description:
GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide. Both GLP-1 (7-36) and GLP-1 (7-37), also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 MW: 3297.7 Da % Peak area by HPLC: 95 Storage condition: -20° C
Catalog Number:
(RK31089)
Supplier:
Restek
Description:
Standard is packaged in isopropanol at a concentration of 2000 µg/mL in a 1 mL ampoule.
Supplier:
DWK Life Sciences (KIMBLE)
Description:
These septa are used for 16 mm screw thread vial screw caps.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.
To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
|
|||||||||