Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

chromatography+columns+HyClone+products+(Cytiva)


72,343  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"72343"
  List View Searching Easy View Easy View (new)
Sort by:
 
 
 
 

Catalog Number: (89328-946)

Supplier:  Genetex
Description:   Rabbit polyclonal antibody to DAD1

Supplier:  Molded Fiber Glass Tray
Description:   MFG Tray conveyor and assembly trays feature a low-profile design and radial edges to readily accommodate conveyor transport and assembly operations in a wide variety of applications
Catalog Number: (89287-946)

Supplier:  Genetex
Description:   Goat Polyclonal antibody to Coronin 3 / coronin 1C (coronin actin binding protein 1C) Purity: Antigen affinity chromatography. Species Reactivity: Human Cow Pig Tested Applications: ELISA WB Pkg Size: 100 ug
Supplier:  KEYSTONE ADJUSTABLE CAP CO., INC.
Description:   Save time and standardize the activities in equipment preparation for sterilization. Leave the covers in place during installation to prevent microbial and particulate contamination. Leave in place while the remaining fill line set-up activities are performed.

Supplier:  Anaspec Inc
Description:   This is fluorescent GLP-1 labeled at the peptide C-terminus with FAM, Abs/Em=494/521 nm. In response to Glucose ingestion, proglucagon in the intestinal L cells is cleaved into GLP-1 (1-36). Prior to secretion into the circulation, GLP-1 (1-36) is further processed into amidated GLP-1 (7-36)-and small amounts of glycine-extended GLP-1 (7-37). Both GLP-1 (7-36) and GLP-1 (7-37), causes glucose dependent release of insulin by pancreatic beta-cells. They also play a role in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 peptides such as GLP-1 (1-36) have been used to investigate restoration of pancreatic beta cell function. GLP-1 is also produced in the central nervous system.
Sequence: FAM-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 4469.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Catalog Number: (89356-630)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to CDH1 (fizzy/cell division cycle 20 related 1 (Drosophila))
Supplier:  Bioss
Description:   C6orf106 is a Making up nearly 6% of the human genome, chromosome 6 contains around 1,200 genes within 170 million base pairs of sequence. Deletion of a portion of the q arm of chromosome 6 is associated with early onset intestinal cancer suggesting the presence of a cancer susceptibility locus. Porphyria cutanea tarda is associated with chromosome 6 through the HFE gene which, when mutated, predisposes an individual to developing this porphyria. Notably, the PARK2 gene, which is associated with Parkinson's disease, and the genes encoding the major histocompatiblity complex proteins, which are key molecular components of the immune system and determine predisposition to rheumatic diseases, are also located on chromosome 6. Stickler syndrome, 21-hydroxylase deficiency and maple syrup urine disease are also associated with genes on chromosome 6. A bipolar disorder susceptibility locus has been identified on the q arm of chromosome 6. The C6orf106 gene product has been provisionally designated C6orf106 pending further characterization.
Supplier:  LIFE TECHNOLOGIES CORP CA
Description:   Pierce™ C18 Tips are ready-to-use pipette-tip columns of C18 resin that enable fast and efficient capture, concentration, desalting and elution of peptides for MALDI mass spectrometry and other methods.
MSDS SDS
Supplier:  Colder Products
Description:   Provide easy, secure sterile connections even in nonsterile environments.
Catalog Number: (89305-066)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to HSP90B

Supplier:  Biotium
Description:   with CF660C. CF660C can still be sufficiently excited by the 633/635 nm laser with emission at 685 nm. CF660C is several fold brighter and significantly more photostable than Alexa Fluor 660.
Supplier:  AGILENT TECHNOLOGIES, INC (CSD) CA
Description:   Perkin Elmer Optima ICP-OES Work/Load Coil and Ignitor Supplies.
Supplier:  Genetex
Description:   Clone: 0841 Purity: Purified by protein A chromatography or sequential differential precipitations Species Reactivity: Virus Tested Applications: ICC/IF Pkg Size: 500 ul
Supplier:  Genetex
Description:   Purity: Purified by protein A chromatography or sequential differential precipitations Species Reactivity: Virus Tested Applications: ELISA, ICC/IF, WB Pkg Size: 500 ul

Supplier:  Enzo Life Sciences
Description:   15-deoxy-Δ12,14-Prostaglandin J2 (15-d-PGJ2) is one of the ultimate dehydration products of PGD2, formed via the intermediate Δ12-PGJ2. 15-d-PGJ2 is physiologically present in body fluids at concentration of 10-12 to 10-9 M, but increases dramatically under stress such as infection and inflammation. 15-d-PGJ2 exerts both pro- and anti-inflammatory effects in a cell-type and concentration-dependent manner, with many of these effects mediated via binding to the γ isoform of the peroxisome proliferators-activated receptor (PPAR-γ). 15-d-PGJ2 appears to induce HO-1 expression by a PPAR-γ-independent mechanism mediated by the generation of reactive oxygen species (ROS).
Catalog Number: (89415-408)

Supplier:  Prosci
Description:   AIF Antibody: Apoptosis is characterized by several morphological nuclear changes including chromatin condensation and nuclear fragmentation. These changes are triggered by the activation of members of caspase family, caspase activated DNase, and several novel proteins. A novel gene, the product of which causes chromatin condensation and DNA fragmentation, was recently identified, cloned, and designated apoptosis inducing factor (AIF). Like the critical molecules, cytochrome c and caspase-9, in apoptosis, AIF localizes in mitochondria. AIF translocates to the nucleus when apoptosis is induced and induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. AIF induces chromatin condensation and large scale DNA fragmentation, which are the hallmarks of apoptosis, of the isolated nucleus and the nucleus in live cells by microinjection and apoptosis stimuli. AIF is highly conserved between human and mouse and widely expressed.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
18,625 - 18,640  of 72,343