Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

chromatography+columns+HyClone+products+(Cytiva)


72,390  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"72390"
  List View Searching Easy View Easy View (new)
Sort by:
 
 
 
 

Supplier:  Bel-Art Products
Description:   This small plastic vacuum desiccator is ideal for degasing liquids quickly and easily in the laboratory or classroom.
Catalog Number: (10406-260)

Supplier:  Bioss
Description:   Mediates interactions of advanced glycosylation end products (AGE). These are nonenzymatically glycosylated proteins which accumulate in vascular tissue in aging and at an accelerated rate in diabetes. Acts as a mediator of both acute and chronic vascular inflammation in conditions such as atherosclerosis and in particular as a complication of diabetes. AGE/RAGE signaling plays an important role in regulating the production/expression of TNF-alpha, oxidative stress, and endothelial dysfunction in type 2 diabetes. Interaction with S100A12 on endothelium, mononuclear phagocytes, and lymphocytes triggers cellular activation, with generation of key proinflammatory mediators. Interaction with S100B after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling (By similarity). Receptor for amyloid beta peptide. Contributes to the translocation of amyloid-beta peptide (ABPP) across the cell membrane from the extracellular to the intracellular space in cortical neurons. ABPP-initiated RAGE signaling, especially stimulation of p38 mitogen-activated protein kinase (MAPK), has the capacity to drive a transport system delivering ABPP as a complex with RAGE to the intraneuronal space. Can also bind oligonucleotides.
Supplier:  MilliporeSigma
Description:   Triton* X-100, Suitable for the biopharmaceutical production EMPROVE* bio Ph Eur, Cas Number: 9002-93-1, Drum stainless, 190L
MSDS SDS
Catalog Number: (65513-725)

Supplier:  Hamilton
Description:   Hamilton Company offers the most comprehensive selection of standard and custom syringes and accessories in the industry
Supplier:  Restek
Description:   Universal angled "Y" Press-Tight® connectors feature a split column flow to two detectors.
Supplier:  Bel-Art Products
Description:   This “A” shaped rack has ten places for holding glass plates and a weighted base for safety.
Supplier:  Medegen Medical Products, LLC
Description:   Medegen laundry and linen bags provide a safe and efficient method of handling soiled or infectious laundry and linen from point of collection, through storage and transport and into final processing.
Supplier:  Remco Products
Description:   This fully color-coded sweeping broom has two types of bristles to pick up every particle
Supplier:  Perfex
Description:   This short handle scrub brush contains stiff polypropylene fiber made for aggressive scrubbing of baked-on deposits.
Small Business Enterprise
Supplier:  Bel-Art Products
Description:   Translucent, flexible bottles with leakproof design and matched polypropylene closures are FDA compliant and offer greater visibility than HDPE bottles.
Supplier:  LIFE TECHNOLOGIES CORP CA
Description:   ABTS substrate is a water-soluble peroxidase substrate that yields a measurable green end product for use in ELISA methods.
MSDS SDS

Supplier:  Anaspec Inc
Description:   GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide. Both GLP-1 (7-36) and GLP-1 (7-37), also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 3297.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Supplier:  Restek
Description:   Use of these liners helps ensure an inert GC flow path for higher sensitivity, accuracy, and reproducibility.

Supplier:  Ahlstrom
Description:   Ahlstrom Grade 243 is one of the thicker chromatography papers available from Ahlstrom
Supplier:  Colder Products
Description:   These quick disconnect couplings are injection molded from acetal thermoplastic, making them highly durable and resistant to most chemical solutions
Supplier:  Production Basics
Description:   Four-post worktable features easy work surface height adjustment from 76.2 to 106.7 cm (30 to 42").
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
8,417 - 8,432  of 72,390