Text Search >
chromatography+columns+HyClone+products+(Cytiva)
Print…
You Searched For:
72,380 results were found
chromatography+columns+HyClone+products+(Cytiva)
Catalog Number:
(10070-268)
Supplier:
Prosci
Description:
Smad3 encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions as a transcriptional modulator activated by transforming growth factor-beta and is thought to play a role in the regulation of carcinogenesis.
Supplier:
Puritan Medical Products
Description:
Environmental sampling device features a polypropylene shaft with prominent thumb stop to indicate hand placement
Catalog Number:
(75794-422)
Supplier:
Prosci
Description:
Interleukin-27 (IL-27) is a heterodimeric group 2 receptor ligand molecule that belongs to the IL-6/IL-12 family of long type I cytokines. It is composed of EBI3 (EBV-induced gene 3), a 34 kDa glycoprotein that is related to the p40 subunit of IL-12 and IL-23, and p28, the cloned 28 kDa glycoprotein that is related to the p35 chain of IL-12. IL-27 is expressed by monocytes, endothelial cells and dendritic cells. IL-27 binds to and signals through a heterodimeric receptor complex composed of WSX1 (TCCR) and gp130. Evidence suggests IL-27 interacts only with WSX-1. IL-27 has both anti- and proinflammatory properties. As an antiinflammatory, IL-27 seems to induce a general negative feedback program that limits T and NK-T cell activity. At the onset of infection, IL-27 induces an IL-12 receptor on naie CD4+ T cells, making them susceptible to subsequent IL-12 activity (and possible Th1 development). Notably, IL-12 family cytokines are both induced and inhibited by bacterial products. Microbes promote IL-27 secretion through TLR4, and also block IL-27 production via C5a induction.
Supplier:
Bel-Art Products
Description:
These forceps are fully coated with brown Teflon® containing FEP and comply with FDA regulations concerning direct food contact.
Catalog Number:
(10477-942)
Supplier:
Bioss
Description:
FAM36A is a multi-pass membrane protein. It belongs to the FAM36 family. The exact function of FAM36A remains unknown.Chromosome 1 is the largest human chromosome spanning about 260 million base pairs and making up 8% of the human genome. There are about 3,000 genes on chromosome 1, and considering the great number of genes there are also a large number of diseases associated with chromosome 1. Notably, the rare aging disease Hutchinson-Gilford progeria is associated with the LMNA gene which encodes lamin A. When defective, the LMNA gene product can build up in the nucleus and cause characteristic nuclear blebs. The mechanism of rapidly enhanced aging is unclear and is a topic of continuing exploration. The MUTYH gene is located on chromosome 1 and is partially responsible for familial adenomatous polyposis. Stickler syndrome, Parkinsons, Gaucher disease and Usher syndrome are also associated with chromosome 1. A breakpoint has been identified in 1q which disrupts the DISC1 gene and is linked to schizophrenia. Aberrations in chromosome 1 are found in a variety of cancers including head and neck cancer, malignant melanoma and multiple myeloma. The FAM36A gene product has been provisionally designated FAM36A pending further characterization.
Supplier:
Puritan Medical Products
Description:
This absorbent cotton tipped applicator is produced with high quality USP grade cotton which is carded and coiled onsite to maintain consistency
Catalog Number:
(77435-278)
Supplier:
PRECISIONARY INSTRUMENTS LLC
Description:
Live one-on-one video session with cryostat technician on using and installing the cryostat from beginning to end. Includes session for Q&A to help you succeed in your experiments and making the best tissue slices.
Catalog Number:
(76079-686)
Supplier:
Bioss
Description:
Lass5, or LAG1 longevity assurance homolog 5, is thought to be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed in cells is involved in the production of sphingolipids containing mainly one fatty acid donnor ceramide) in a fumonisin B1-independent manner.
Catalog Number:
(76085-098)
Supplier:
Bioss
Description:
This gene encodes a membrane-bound adenylate cyclase that catalyses the formation of cyclic AMP from ATP and is inhibitable by calcium. The product of this gene is a member of the adenylyl cyclase class-4/guanylyl cyclase enzyme family that is characterized by the presence of twelve membrane-spanning domains in its sequences.
Supplier:
Puritan Medical Products
Description:
These swabs have thermal edge seals and thermal bonding to the nadle help ensure the sponge-like foam will clean up unwanted particles without releasing any into your critical environment.
Catalog Number:
(TCB2775-100MG)
Supplier:
TCI America
Description:
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal Specific rotation [a]20/D: 17 deg (C=1, H2O) Molecular Formula: C18H24N2
Catalog Number:
(72310-314)
Supplier:
Hamilton
Description:
0.2-3uL. Model: 701. Sample volume:.2 -3uL. Sample wets only the disposable PTFE tips, eliminating sample cross-contamination. Spring loaded plunger and adjustable stops ensure excellent reproducibility.
Catalog Number:
(102996-408)
Supplier:
Anaspec Inc
Description:
This GLP-1 (7-36)amide contains an additional Lysine (K) residue at its N-terminus, with Biotin coupled to the Lysine side chain. GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (Cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37) - Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) - Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2 MW: 3551.8 Da % Peak area by HPLC: 95 Storage condition: -20° C
Supplier:
NATIONAL SCIENTIFIC COMPANY
Description:
Choose Thermo Scientific™ SureSTART™ 2 ml glass snap vials, performance level 2, to ensure high quality data with an uninterrupted workflow in high-throughput applications using GC, HPLC/UHPLC, and single or triple quadrupole MS systems.
Catalog Number:
(77439-146)
Supplier:
Bioss
Description:
Nitric oxide (NO) is an inorganic, gaseous free radical that carries a variety of messages between cells. Vasorelaxation, neurotransmission and cytotoxicity can all be potentiated through cellular response to NO. NO production is mediated by members of the nitric oxide synthase (NOS) family. NOS catalyzes the oxidization of L-arginine to produce L-citrulline and NO. Two constitutive isoforms, brain or neuronal NOS (b or nNOS, type I) & endothelial cell NOS (eNOS, type III), and one inducible isoform (iNOS, type II), have been cloned. All NOS isoforms contain calmodulin, nicotinamide adenine dinucleotide phosphate (NADPH), flavin adenine dinucleotide (FAD), and flavin mononucleotide (FMN) binding domains. Nitric oxide synthase is expressed in liver, macrophages, hepatocytes, synoviocytes, stimulated glial cells and smooth muscle cells. Cytokines such as interferon-gamma (IFN), tumor necrosis factor (TNF), interleukin-1 and -2, and lipopolysaccarides (LPS) cause an increase in iNOS mRNA, protein, and activity levels. Protein kinase C-stimulating agents exhibit the same effect on iNOS activity. After cytokine induction, iNOS exhibits a delayed activity response which is then followed by a significant increase in NO production over a long period of time. Human iNOS is regulated by calcium/calmodulin (in contrast with mouse NOS2).
Supplier:
AGILENT TECHNOLOGIES, INC (CSD) CA
Description:
Graphite/Vespel (15/85%) ferrules, available in different configurations, provide leak-free connections between the column and injector on your GC.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.
To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
|
|||||||||
List View
