Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?
  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

chromatography+columns+HyClone+products+(Cytiva)


72,371  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"72371"
  List View Searching Easy View Easy View (new)
Sort by:
 
 
 
 

Catalog Number: (89314-290)

Supplier:  Genetex
Description:   Purity: Purified by antigen-affinity chromatography. Tested Applications: WB-Ag Pkg Size: 100 ul
Supplier:  Restek
Description:   Polyethylene and polypropylene parts and accessories are available for maintance of Resprep® SPE tubes.
Supplier:  Restek
Description:   These 1/4" compression end-fittings are compatible with 1/16" connecting tubing using Valco® and Parker fittings.
Catalog Number: (CA10065-276)

Supplier:  LONZA PHARMA - BIOSCIENCE CA
Description:   Clonetics® AGM® Astrocyte Growth Medium has been developed to support the growth of primary astrocytes. Media products are provided as convenient BulletKits® which contain basal medium and necessary growth factors for cell culture.
Supplier:  Bioss
Description:   Pancreatic amylase is a digestive enzyme secreted by the pancreas. It consists of a single polypeptide chain with a molecular weight of 54 kDa.Pancreatic amylase and salivary amylase are the products of separate genes and, although they share 98% amino acid sequence homology, they differ in molecular size, isoelectric point and antigenic properties. Measurement of amylase concentrations in serum is a diagnostic test for various pancreatic disorders (especially acute and relapsing pancreatitis).
Supplier:  Restek
Description:   Buffer salts and metals from the HPLC system become imbedded on the surface of the piston seal and gradually wear the surface of the piston rod.

Supplier:  Thermo Scientific
Description:   Seals have attached septa, unless otherwise specified.
Supplier:  Bioss
Description:   Glycolytic enzyme that catalyzes the transfer of a phosphoryl group from phosphoenolpyruvate (PEP) to ADP, generating ATP. Stimulates POU5F1-mediated transcriptional activation. Plays a general role in caspase independent cell death of tumor cells. The ratio betwween the highly active tetrameric form and nearly inactive dimeric form determines whether glucose carbons are channeled to biosynthetic processes or used for glycolytic ATP production. The transition between the 2 forms contributes to the control of glycolysis and is important for tumor cell proliferation and survival.

Supplier:  Restek
Catalog Number: (103003-042)

Supplier:  Anaspec Inc
Description:   Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
Molecular Weight: 4074.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: (10411-718)

Supplier:  Bioss
Description:   GM-CSF Receptor Beta is the v subunit of the heterodimeric receptor for colony stimulating factor 2, a cytokine which controls the production, differentiation, and function of granulocytes and macrophages. The encoded protein is a member of the cytokine family of receptors. This gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes. Six transcript variants encoding five different isoforms have been found for this gene, with some of the isoforms being membrane-bound and others being soluble.
Catalog Number: (10351-448)

Supplier:  Bioss
Description:   The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase. The different transcripts result from the use of alternate transcription initiation sites. [provided by RefSeq, Jul 2008].

Supplier:  Bioss
Description:   Regulates voltage-gated potassium channels assembled from KCNA1, KCNA4 and KCNAB1. It slows down channel inactivation by precluding channel closure mediated by the KCNAB1 subunit. Ligand for ADAM22 that positively regulates synaptic transmission mediated by AMPA-type glutamate receptors (By similarity). Plays a role in suppressing the production of MMP1/3 through the phosphatidylinositol 3-kinase/ERK pathway. May play a role in the control of neuroblastoma cell survival.
Supplier:  SPEX CERTIPREP LLC
Description:   Single-element standards for ion chromatography and ion selective electodes.
Supplier:  SPEX CERTIPREP LLC
Description:   Single-element standards for ion chromatography and ion selective electodes.
Supplier:  Ace Glass
Description:   Short-Path distillation head with integral vigreux vapor path column.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
10,609 - 10,624  of 72,371