Text Search >
electrophoresis+reagents+HyClone+products+(Cytiva)
Print…
You Searched For:
58,214 results were found
electrophoresis+reagents+HyClone+products+(Cytiva)
Catalog Number:
(CAAA88078-AE)
Supplier:
Thermo Scientific Chemicals
Description:
Molecular Formula: Mn in 5% HNO3
Physical Form: Liquid UN No.: 3264 MDL No.: MFCD00011111
Supplier:
Optimize
Description:
OPTI-LOK Fittings are ideal for high-pressure connections with ¹/₁₆" outer Ø tubing. All Optimize fittings are precision machined for optimal quality and thread consistency and are designed for trouble-free operation at pressures of up to 6000 psi.
Supplier:
Spectrum Chemicals
Description:
POTASSIUM ACETATE, CRYSTALLINE POWDER, USP is, as its name suggests, the potassium salt of acetic acid and is used as a catalyst for producing polyurethanes. In the food industry it is used as a food additive, an acidity regulator and a preservative. It can also be found in medicine and biochemistry where it's employed to help treat diabetic ketoacidosis. Spectrum Chemical USP products are manufactured, packaged and stored under current Good Manufacturing Practices (cGMP) per 21CFR part 211 in FDA registered and inspected facilities.
Storage temperature - DELIQUESCENT: Keep tightly closed.
Catalog Number:
(76109-804)
Supplier:
Bioss
Description:
Calcium-activated non selective (CAN) cation channel that mediates membrane depolarization. While it is activated by increase in intracellular Ca(2+), it is impermeable to it. Mediates transport of monovalent cations (Na(+) > K(+) > Cs(+) > Li(+)), leading to depolarize the membrane. It thereby plays a central role in cadiomyocytes, neurons from entorhinal cortex, dorsal root and vomeronasal neurons, endocrine pancreas cells, kidney epithelial cells, cochlea hair cells etc. Participates in T-cell activation by modulating Ca(2+) oscillations after T lymphocyte activation, which is required for NFAT-dependent IL2 production. Involved in myogenic constriction of cerebral arteries. Controls insulin secretion in pancreatic beta-cells. May also be involved in pacemaking or could cause irregular electrical activity under conditions of Ca(2+) overload. Affects T-helper 1 (Th1) and T-helper 2 (Th2) cell motility and cytokine production through differential regulation of calcium signaling and NFATC1 localization. Enhances cell proliferation through up-regulation of the beta-catenin signaling pathway.
Catalog Number:
(76509-922)
Supplier:
Genscript
Description:
The product is specific for Obinutuzumab. The antibody is recommended as a detection antibody in a pharmacokinetic (PK) bridging assay with capture antibody GenScript, A01945-40, Anti-Obinutuzumab Antibody (18H8), mAb, Mouse.
Catalog Number:
(76509-940)
Supplier:
Genscript
Description:
The product is specific for Adalimumab. The antibody is recommended as a detection antibody in a pharmacokinetic (PK) bridging assay with capture antibody GenScript, A01954-40, Anti- Adalimumab Antibody (15C7), mAb, Mouse.
Catalog Number:
(76509-920)
Supplier:
Genscript
Description:
The product is specific for Obinutuzumab. The antibody is recommended as a detection antibody in a pharmacokinetic (PK) bridging assay with capture antibody GenScript, A01945-40, Anti-Obinutuzumab Antibody (18H8), mAb, Mouse.
Catalog Number:
(76509-950)
Supplier:
Genscript
Description:
The product is specific for Ipilimumab. The antibody is recommended as a detection antibody in a pharmacokinetic (PK) bridging assay with capture antibody GenScript, A01859-40, Anti- Ipilimumab Antibody (26B6H7D9), mAb, Mouse.
Catalog Number:
(76510-086)
Supplier:
Genscript
Description:
The product is specific for ranibizumab. The antibody is recommended as a capture antibody in a pharmacokinetic (PK) bridging assay with detection antibody GenScript, A02036-40, anti-ranibizumab antibody (10D12), mAb, mouse.
Catalog Number:
(CA872-99)
Supplier:
Hach
Description:
For determination of phenols by the 4-Aminoantipyrine Method
Catalog Number:
(76007-692)
Supplier:
Remco Products
Description:
The hygienic rake is mostly used for emptying out fresh produce from large containers
Catalog Number:
(89133-778)
Supplier:
Puritan Medical Products
Description:
This specialty foam tipped applicator is produced with 100ppi reticulated medical grade foam
Catalog Number:
(103006-992)
Supplier:
Anaspec Inc
Description:
Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL Molecular Weight: 3787.2 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(75812-452)
Supplier:
Spectrum Chemicals
Description:
Sodium Iodide, USP is a crystalline salt that is white and is used as a food supplement to counter and prevent iodine deficiencies. All Spectrum Chemical USP products are manufactured, packaged and stored under current Good Manufacturing Practices (cGMP) per 21CFR part 211 in FDA registered and inspected facilities
Catalog Number:
(470006-910)
Supplier:
Bel-Art
Description:
The orbital shaker platform turns a standard magnetic stirrer into an orbital shaking platform saving the expense and space requirements of additional lab equipment.
Catalog Number:
(76509-924)
Supplier:
Genscript
Description:
The product is specific for Atezolizumab. The antibody is recommended as a capture antibody in a pharmacokinetic (PK) bridging assay with detection antibody GenScript, A01950-40, Anti-Atezolizumab Antibody (6B12) [Biotin], mAb, Mouse.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.
To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
|
|||||||||
List View
